PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo1G0035900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 674aa    MW: 74779.3 Da    PI: 7.9126
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo1G0035900genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding65.11.3e-2070116148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT+eEdell++av+q+ g++Wk+Ia+ ++ gRt+ qc +rwqk+l
   Spipo1G0035900  70 KGGWTEEEDELLARAVRQFKGKNWKKIAELFP-GRTDVQCLHRWQKVL 116
                      688*****************************.************986 PP

2Myb_DNA-binding59.57.6e-19122168148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEde ++++v+++G + W+tIa++m  gR +kqc++rw+++l
   Spipo1G0035900 122 KGAWTKEEDECIIKLVNKYGAKKWATIANKMT-GRIGKQCRERWHNHL 168
                      79*****************************9.*************97 PP

3Myb_DNA-binding50.93.5e-16175216245
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       +WTteE+ +l++a+ ++G++ W+ Ia+ ++ gR ++++k++w+
   Spipo1G0035900 175 CAWTTEEEIILIRAHGMYGNK-WAEIAKLLP-GRADNSIKNHWN 216
                      68*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.11665116IPR017930Myb domain
SuperFamilySSF466892.66E-1667122IPR009057Homeodomain-like
SMARTSM007171.8E-1769118IPR001005SANT/Myb domain
PfamPF002493.5E-1870116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-2472132IPR009057Homeodomain-like
CDDcd001671.25E-1573116No hitNo description
PROSITE profilePS5129431.2117172IPR017930Myb domain
SuperFamilySSF466897.11E-31119215IPR009057Homeodomain-like
SMARTSM007175.4E-17121170IPR001005SANT/Myb domain
PfamPF002493.6E-17122168IPR001005SANT/Myb domain
CDDcd001673.93E-15124168No hitNo description
Gene3DG3DSA:1.10.10.604.7E-24133175IPR009057Homeodomain-like
PROSITE profilePS5129420.986173223IPR017930Myb domain
SMARTSM007171.7E-14173221IPR001005SANT/Myb domain
PfamPF002491.8E-14174216IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-21176223IPR009057Homeodomain-like
CDDcd001675.23E-11176216No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 674 aa     Download sequence    Send to blast
MIVKGIQGEP EDKREVEATK EEEVDVDDKT VEESARDPSS TISDSSCQSS LAKPSPVPGR  60
IRGPARRSTK GGWTEEEDEL LARAVRQFKG KNWKKIAELF PGRTDVQCLH RWQKVLDPEL  120
VKGAWTKEED ECIIKLVNKY GAKKWATIAN KMTGRIGKQC RERWHNHLNP AIKKCAWTTE  180
EEIILIRAHG MYGNKWAEIA KLLPGRADNS IKNHWNCSVK KKLDSYLSSG LLDSSNKNGA  240
LDLNSGLSVR GQPHDLVTQQ ASMELDEKST TAKAFNASSP NLPRENESSR NPRENSDYCK  300
TIAQPLSMEI PRSSRGIPDY IKAFADKNLD ATSPTGRCLT YLASGEDSNH ATARDYGTSF  360
CCKNDYSHRT TSNAILPVTT QPNPSAQMAI HGFITKELFA SPEKSERHAK SMDNLDAPRT  420
SSKLSEHHTP AILENTPMDV ENAADSNETP CTPVPVDMEV LDHDRYVPSQ SSGLHKNIRK  480
FRILESDKPS SEFGSPNFYY GSPRSSRATS VKFWDPEAIL RNAAMTFRKT PSIISKGRQN  540
NSGSSPTTTP CKTAVDSTPR AESVASSMAH AYLHQYEIEM PVDQKSNDAQ HVRQLFPSSS  600
APSKSRIRGA VESVEKRPLE HTSDGEWNDT DTSHSPAFDV GKHIKNPKNS QDQPGSLGRS  660
FSNRTHETIA TYD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-65732239159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-65732239159MYB PROTO-ONCOGENE PROTEIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30993880
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.21e-84myb domain protein 3r-4